CDC25B anticorps

N° du produit ABIN634076

Détail du produit anti-CDC25B anticorps

Antigène: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDC25B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: CDC25 B antibody was raised using a synthetic peptide corresponding to a region with amino acids TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDC25B Blocking Peptide, catalog no. 33R-9253, is also available for use as a blocking control in assays to test for specificity of this CDC25B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDC25B

Antigène: CDC25B (Cell Division Cycle 25 Homolog B (S. Pombe) (CDC25B))

Autre désignation: CDC25B (CDC25B Produits)

Synonymes: anticorps CDC25B, anticorps AI604853, anticorps cell division cycle 25B, anticorps cdc25b, anticorps CDC25B, anticorps Cdc25b

Sujet: CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Cycle Cellulaire, M Phase, Autophagy