CDKN3 anticorps

N° du produit ABIN634079

Détail du produit anti-CDKN3 anticorps

Antigène: CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDKN3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDKN3 Blocking Peptide, catalog no. 33R-1720, is also available for use as a blocking control in assays to test for specificity of this CDKN3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDKN3

Antigène: CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))

Autre désignation: CDKN3 (CDKN3 Produits)

Synonymes: anticorps CDI1, anticorps CIP2, anticorps KAP, anticorps KAP1, anticorps CDKN3, anticorps 2410006H10Rik, anticorps K24G6.15, anticorps K24G6_15, anticorps KIP-RELATED PROTEIN 3, anticorps KRP3, anticorps inhibitor/interactor with cyclin-dependent kinase, anticorps cyclin dependent kinase inhibitor 3, anticorps cyclin-dependent kinase inhibitor 3, anticorps inhibitor/interactor with cyclin-dependent kinase, anticorps CDKN3, anticorps cdkn3, anticorps Cdkn3, anticorps ICK6

Sujet: The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.

Poids moléculaire: 23 kDa (MW of target protein)