RFC3 anticorps

N° du produit ABIN634080

Détail du produit anti-RFC3 anticorps

Antigène: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFC3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFC3 Blocking Peptide, catalog no. 33R-10126, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFC3

Antigène: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Autre désignation: RFC3 (RFC3 Produits)

Synonymes: anticorps CG5313, anticorps DRFC, anticorps DmRFC3, anticorps Dmel\\CG5313, anticorps Rfc3, anticorps 21.m02902, anticorps 2810416I22Rik, anticorps 38kDa, anticorps AU022547, anticorps Recc3, anticorps cb275, anticorps RFC38, anticorps Replication factor C subunit 3, anticorps replication factor C3, anticorps replication factor C subunit 3, anticorps replication factor C 38 kDa subunit, anticorps DNA replication factor C complex subunit Rfc3, anticorps replication factor C3, putative, anticorps replication factor C (activator 1) 3, anticorps replication factor C subunit 3 L homeolog, anticorps RfC3, anticorps PF14_0601, anticorps Chro.30359, anticorps PB000006.01.0, anticorps PC000345.04.0, anticorps TP04_0380, anticorps Tb09.211.3310, anticorps PY04255, anticorps PVX_117300, anticorps BBOV_IV003080, anticorps SJAG_02182, anticorps PKH_124240, anticorps rfc3, anticorps Rfc3, anticorps RFC3, anticorps rfc3.L

Sujet: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA