STAG3 anticorps (Middle Region)
-
- Antigène Voir toutes STAG3 Anticorps
- STAG3 (Stromal Antigen 3 (STAG3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STAG3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- STAG3 antibody was raised against the middle region of STAG3
- Purification
- Affinity purified
- Immunogène
- STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
- Top Product
- Discover our top product STAG3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STAG3 Blocking Peptide, catalog no. 33R-9729, is also available for use as a blocking control in assays to test for specificity of this STAG3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAG3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STAG3 (Stromal Antigen 3 (STAG3))
- Autre désignation
- STAG3 (STAG3 Produits)
- Synonymes
- anticorps STAG3, anticorps SA-2, anticorps stromal antigen 3, anticorps STAG3, anticorps stag3, anticorps Stag3
- Sujet
- STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
- Poids moléculaire
- 135 kDa (MW of target protein)
-