MCM3 anticorps (C-Term)
-
- Antigène Voir toutes MCM3 Anticorps
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MCM3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MCM3 antibody was raised against the C terminal of MCM3
- Purification
- Affinity purified
- Immunogène
- MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
- Top Product
- Discover our top product MCM3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MCM3 Blocking Peptide, catalog no. 33R-8710, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
- Autre désignation
- MCM3 (MCM3 Produits)
- Synonymes
- anticorps HCC5, anticorps P1-MCM3, anticorps P1.h, anticorps RLFB, anticorps AL033361, anticorps C80350, anticorps Mcmd, anticorps P1, anticorps p1.m, anticorps cb32, anticorps chunp6867, anticorps wu:fa26g03, anticorps CG4206, anticorps DmMCM3, anticorps DmMcm3, anticorps DmeMCM3, anticorps Dmel\\CG4206, anticorps MCM3, anticorps McM3, anticorps Mcp-PCR2, anticorps PCR2, anticorps dMCM3, anticorps xmcm3, anticorps minichromosome maintenance complex component 3, anticorps MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), anticorps Minichromosome maintenance 3, anticorps minichromosome maintenance complex component 3 L homeolog, anticorps MCM complex subunit Mcm3, anticorps MCM3, anticorps mcm3, anticorps Mcm3, anticorps mcm3.L
- Sujet
- MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.
- Poids moléculaire
- 89 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-