RAN anticorps (Middle Region)

N° du produit ABIN634102

Détail du produit anti-RAN anticorps

Antigène: RAN (RAN, Member RAS Oncogene Family (RAN))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAN est non-conjugé

Application: Western Blotting (WB)

Specificité: Ran antibody was raised against the middle region of RAN

Purification: Affinity purified

Immunogène: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ran Blocking Peptide, catalog no. 33R-6771, is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAN

Antigène: RAN (RAN, Member RAS Oncogene Family (RAN))

Autre désignation: Ran (RAN Produits)

Synonymes: anticorps ARA24, anticorps Gsp1, anticorps TC4, anticorps ran, anticorps ara24, anticorps gsp1, anticorps ran-1, anticorps tc4, anticorps RAN, anticorps RANP1, anticorps AAF30287, anticorps CG1404, anticorps Dmel\CG1404, anticorps Ran, anticorps dran, anticorps l(1)G0075, anticorps ran10A, anticorps fc16b04, anticorps wu:fc16b04, anticorps RAN, member RAS oncogene family, anticorps RAN, member RAS oncogene family S homeolog, anticorps CG1404 gene product from transcript CG1404-RC, anticorps RAN, anticorps Ran, anticorps ran.S, anticorps ran

Sujet: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus