NPM2 anticorps (N-Term)

N° du produit ABIN634104

Détail du produit anti-NPM2 anticorps

Antigène: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NPM2 antibody was raised against the N terminal of NPM2

Purification: Affinity purified

Immunogène: NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NPM2 Blocking Peptide, catalog no. 33R-4898, is also available for use as a blocking control in assays to test for specificity of this NPM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NPM2

Antigène: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Autre désignation: NPM2 (NPM2 Produits)

Synonymes: anticorps nucleophosmin/nucleoplasmin 2, anticorps Npm2, anticorps NPM2

Sujet: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Poids moléculaire: 24 kDa (MW of target protein)