KIF2A anticorps (C-Term)

N° du produit ABIN634105

Détail du produit anti-KIF2A anticorps

Antigène: KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF2A est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF2 A antibody was raised against the C terminal of KIF2

Purification: Affinity purified

Immunogène: KIF2 A antibody was raised using the C terminal of KIF2 corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF2A Blocking Peptide, catalog no. 33R-2768, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF2A

Antigène: KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))

Autre désignation: KIF2A (KIF2A Produits)

Synonymes: anticorps HK2, anticorps KIF2, anticorps C530030B14Rik, anticorps Kif2, anticorps Kns2, anticorps M-kinesin, anticorps kif2-a, anticorps fj55b02, anticorps wu:fj55b02, anticorps kinesin family member 2A, anticorps kinesin heavy chain member 2A L homeolog, anticorps kinesin heavy chain member 2A, anticorps zgc:103670, anticorps Kinesin-2, anticorps KIF2A, anticorps Kif2a, anticorps kif2a.L, anticorps zgc:103670, anticorps GL50803_17333, anticorps GL50803_16456

Sujet: KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, Ribonucleoprotein Complex Subunit Organization