KIF1A anticorps (N-Term)

N° du produit ABIN634107

Détail du produit anti-KIF1A anticorps

Antigène: KIF1A (Kinesin Family Member 1A (KIF1A))

Épitope: N-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF1A est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF1 A antibody was raised against the N terminal of KIF1

Purification: Affinity purified

Immunogène: KIF1 A antibody was raised using the N terminal of KIF1 corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF1A

Antigène: KIF1A (Kinesin Family Member 1A (KIF1A))

Autre désignation: KIF1A (KIF1A Produits)

Synonymes: anticorps ATSV, anticorps C630002N23Rik, anticorps Gm1626, anticorps Kns1, anticorps C2orf20, anticorps HSN2C, anticorps MRD9, anticorps SPG30, anticorps UNC104, anticorps kinesin family member 1A, anticorps kinesin family member 1Aa, anticorps KIF1A, anticorps kif1a, anticorps Kif1a, anticorps kif1aa

Sujet: The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.

Poids moléculaire: 191 kDa (MW of target protein)