MCM8 anticorps (N-Term)

N° du produit ABIN634124

Détail du produit anti-MCM8 anticorps

Antigène: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM8 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM8 antibody was raised against the N terminal of MCM8

Purification: Affinity purified

Immunogène: MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM8 Blocking Peptide, catalog no. 33R-2568, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM8

Antigène: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Autre désignation: MCM8 (MCM8 Produits)

Synonymes: anticorps C20orf154, anticorps dJ967N21.5, anticorps 5730432L01Rik, anticorps minichromosome maintenance 8 homologous recombination repair factor, anticorps minichromosome maintenance 8 homologous recombination repair factor L homeolog, anticorps MCM8, anticorps Mcm8, anticorps mcm8.L

Sujet: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.

Poids moléculaire: 94 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA