MCM9 anticorps (N-Term)
-
- Antigène Voir toutes MCM9 Anticorps
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MCM9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MCM9 antibody was raised against the N terminal of MCM9
- Purification
- Affinity purified
- Immunogène
- MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
- Top Product
- Discover our top product MCM9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
- Autre désignation
- MCM9 (MCM9 Produits)
- Synonymes
- anticorps C6orf61, anticorps MCMDC1, anticorps dJ329L24.1, anticorps dJ329L24.3, anticorps 9030408O17Rik, anticorps Gm235, anticorps Mcmdc1, anticorps RGD1560557, anticorps mcm9, anticorps minichromosome maintenance 9 homologous recombination repair factor, anticorps minichromosome maintenance 9 homologous recombination repair factor L homeolog, anticorps MCM9, anticorps Mcm9, anticorps mcm9.L
- Sujet
- MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
- Poids moléculaire
- 44 kDa (MW of target protein)
-