Hexokinase 2 anticorps (N-Term)

N° du produit ABIN634132

Détail du produit anti-Hexokinase 2 anticorps

Antigène: Hexokinase 2 (HK2)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Hexokinase 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Hexokinase 2 antibody was raised against the N terminal of HK2

Purification: Affinity purified

Immunogène: Hexokinase 2 antibody was raised using the N terminal of HK2 corresponding to a region with amino acids GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Hexokinase 2 Blocking Peptide, catalog no. 33R-3606, is also available for use as a blocking control in assays to test for specificity of this Hexokinase 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Hexokinase 2

Antigène: Hexokinase 2 (HK2)

Autre désignation: Hexokinase 2 (HK2 Produits)

Synonymes: anticorps HKII, anticorps HXK2, anticorps AI642394, anticorps hexokinase-2, anticorps fi09d05, anticorps fi17h06, anticorps wu:fi09d05, anticorps wu:fi17h06, anticorps wu:fi31b04, anticorps zgc:55926, anticorps HK2, anticorps ARABIDOPSIS THALIANA HEXOKINASE 2, anticorps ATHXK2, anticorps F6F22.11, anticorps F6F22_11, anticorps HEXOKINASE 2, anticorps hexokinase 2, anticorps StHK2, anticorps hexokinase 2, anticorps hexokinase-2, anticorps hexokinase 2 L homeolog, anticorps HK2, anticorps Hk2, anticorps hk2, anticorps HXK2, anticorps LOC100032849, anticorps hk2.L, anticorps hxk2, anticorps LOC102577690

Sujet: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway.

Poids moléculaire: 102 kDa (MW of target protein)

Pathways: Signalisation PI3K-Akt, Carbohydrate Homeostasis, L'effet Warburg