KIF25 anticorps (N-Term)

N° du produit ABIN634135

Détail du produit anti-KIF25 anticorps

Antigène: KIF25 (Kinesin Family Member 25 (KIF25))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF25 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF25 antibody was raised against the N terminal of KIF25

Purification: Affinity purified

Immunogène: KIF25 antibody was raised using the N terminal of KIF25 corresponding to a region with amino acids TWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF25 Blocking Peptide, catalog no. 33R-9383, is also available for use as a blocking control in assays to test for specificity of this KIF25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF25

Antigène: KIF25 (Kinesin Family Member 25 (KIF25))

Autre désignation: KIF25 (KIF25 Produits)

Synonymes: anticorps KNSL3, anticorps kinesin family member 25, anticorps KIF25

Sujet: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

Poids moléculaire: 35 kDa (MW of target protein)