GSPT2 anticorps (N-Term)

N° du produit ABIN634138

Détail du produit anti-GSPT2 anticorps

Antigène: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSPT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GSPT2 antibody was raised against the N terminal of GSPT2

Purification: Affinity purified

Immunogène: GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSPT2 Blocking Peptide, catalog no. 33R-5685, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSPT2

Antigène: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Autre désignation: GSPT2 (GSPT2 Produits)

Synonymes: anticorps ERF3B, anticorps GST2, anticorps G1 to S phase transition 2, anticorps GSPT2, anticorps Gspt2

Sujet: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells.

Poids moléculaire: 69 kDa (MW of target protein)