BCAT1 anticorps (N-Term)

N° du produit ABIN634139

Détail du produit anti-BCAT1 anticorps

Antigène: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BCAT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: BCAT1 antibody was raised against the N terminal of BCAT1

Purification: Affinity purified

Immunogène: BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCAT1 Blocking Peptide, catalog no. 33R-6125, is also available for use as a blocking control in assays to test for specificity of this BCAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BCAT1

Antigène: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Autre désignation: BCAT1 (BCAT1 Produits)

Synonymes: anticorps fj66g02, anticorps zgc:73157, anticorps wu:fj66g02, anticorps Bcatc, anticorps BCATC, anticorps BCT1, anticorps ECA39, anticorps MECA39, anticorps PNAS121, anticorps PP18, anticorps BCATc, anticorps Eca39, anticorps branched chain amino-acid transaminase 1, cytosolic, anticorps branched chain amino acid transaminase 1, anticorps branched chain amino-acid transaminase 1, cytosolic L homeolog, anticorps branched chain aminotransferase 1, cytosolic, anticorps bcat1, anticorps BCAT1, anticorps bcat1.L, anticorps Bcat1

Sujet: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth.

Poids moléculaire: 43 kDa (MW of target protein)