PBK anticorps (N-Term)
-
- Antigène Voir toutes PBK Anticorps
- PBK (PDZ Binding Kinase (PBK))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PBK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PBK antibody was raised against the N terminal of PBK
- Purification
- Affinity purified
- Immunogène
- PBK antibody was raised using the N terminal of PBK corresponding to a region with amino acids SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ
- Top Product
- Discover our top product PBK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PBK Blocking Peptide, catalog no. 33R-8581, is also available for use as a blocking control in assays to test for specificity of this PBK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PBK (PDZ Binding Kinase (PBK))
- Autre désignation
- PBK (PBK Produits)
- Synonymes
- anticorps PBK, anticorps topk, anticorps CT84, anticorps Nori-3, anticorps SPK, anticorps TOPK, anticorps 2810434B10Rik, anticorps AW538537, anticorps D14Ertd732e, anticorps zgc:92050, anticorps PDZ binding kinase, anticorps PDZ binding kinase L homeolog, anticorps PBK, anticorps pbk, anticorps Pbk, anticorps pbk.L
- Sujet
- PBK is a serine/threonine kinase related to the dual specific mitogen-activated protein kinase kinase (MAPKK) family. Evidence suggests that mitotic phosphorylation is required for its catalytic activity. This mitotic kinase may be involved in the activation of lymphoid cells and support testicular functions, with a suggested role in the process of spermatogenesis.
- Poids moléculaire
- 36 kDa (MW of target protein)
-