ORC4 anticorps
-
- Antigène Voir toutes ORC4 Anticorps
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ORC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
- Top Product
- Discover our top product ORC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
- Autre désignation
- ORC4L (ORC4 Produits)
- Synonymes
- anticorps ORC4L, anticorps ORC4P, anticorps Orc4P, anticorps Orc4l, anticorps mMmORC4, anticorps CG2917, anticorps DmORC4, anticorps Dmel\\CG2917, anticorps ORC, anticorps ORC4, anticorps dmOrc4, anticorps orc4, anticorps rDmORC, anticorps orc4l, anticorps fc50c03, anticorps wu:fc50c03, anticorps zgc:85772, anticorps ATORC4, anticorps F23H14.9, anticorps F23H14_9, anticorps ORIGIN RECOGNITION COMPLEX SUBUNIT 4, anticorps origin recognition complex subunit 4, anticorps origin recognition complex subunit 4, anticorps origin recognition complex, subunit 4, anticorps Origin recognition complex subunit 4, anticorps origin recognition complex subunit 4 L homeolog, anticorps origin recognition complex subunit Orc4, anticorps ORC4, anticorps Orc4, anticorps orc4.L, anticorps orc4, anticorps CNM01830
- Sujet
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-