BTG4 anticorps (Middle Region)
-
- Antigène Voir toutes BTG4 Anticorps
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BTG4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BTG4 antibody was raised against the middle region of BTG4
- Purification
- Affinity purified
- Immunogène
- BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
- Top Product
- Discover our top product BTG4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BTG4 (B-Cell Translocation Gene 4 (BTG4))
- Autre désignation
- BTG4 (BTG4 Produits)
- Synonymes
- anticorps SCIR-27, anticorps b9-a, anticorps pc3b, anticorps C86116, anticorps PC3B, anticorps BTG anti-proliferation factor 4, anticorps BTG family member 4 L homeolog, anticorps B cell translocation gene 4, anticorps Btg4, anticorps btg4.L, anticorps BTG4
- Sujet
- The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
- Poids moléculaire
- 26 kDa (MW of target protein)
-