KIF5B anticorps (N-Term)

N° du produit ABIN634172

Détail du produit anti-KIF5B anticorps

Antigène: KIF5B (Kinesin Family Member 5B (KIF5B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF5B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KIF5 B antibody was raised against the N terminal of KIF5

Purification: Affinity purified

Immunogène: KIF5 B antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF5B Blocking Peptide, catalog no. 33R-1753, is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF5B

Antigène: KIF5B (Kinesin Family Member 5B (KIF5B))

Autre désignation: KIF5B (KIF5B Produits)

Synonymes: anticorps KINH, anticorps KNS, anticorps KNS1, anticorps UKHC, anticorps Khc, anticorps AL022807, anticorps Khcs, anticorps Kns1, anticorps Ukhc, anticorps khc, anticorps KIF5A, anticorps kinesin family member 5B, anticorps kinesin heavy chain, anticorps kinesin-1, anticorps kinesin-1 heavy chain, anticorps kinesin family member 5B S homeolog, anticorps KIF5B, anticorps LOC411769, anticorps cgd6_2790, anticorps kin-1, anticorps Tb927.1.1350, anticorps LACBIDRAFT_305999, anticorps Khc, anticorps LOC100538629, anticorps Kif5b, anticorps kif5b.S

Sujet: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Ribonucleoprotein Complex Subunit Organization