KIF3A anticorps (C-Term)

N° du produit ABIN634174

Détail du produit anti-KIF3A anticorps

Antigène: KIF3A (Kinesin Family Member 3A (KIF3A))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF3A est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF3 A antibody was raised against the C terminal of KIF3

Purification: Affinity purified

Immunogène: KIF3 A antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF3A Blocking Peptide, catalog no. 33R-7417, is also available for use as a blocking control in assays to test for specificity of this KIF3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF3A

Antigène: KIF3A (Kinesin Family Member 3A (KIF3A))

Autre désignation: KIF3A (KIF3A Produits)

Synonymes: anticorps FLA10, anticorps KLP-20, anticorps 111-11-71, anticorps 111-11-86, anticorps AW124694, anticorps Kif3, anticorps Kifl, anticorps Kns3, anticorps kinesin family member 3A, anticorps kinesin family member 3a, anticorps KIF3A, anticorps Kif3a

Sujet: KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Signalisation Hedgehog