KIF12 anticorps (N-Term)

N° du produit ABIN634175

Détail du produit anti-KIF12 anticorps

Antigène: KIF12 (Kinesin Family Member 12 (KIF12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KIF12 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIF12 antibody was raised against the N terminal of KIF12

Purification: Affinity purified

Immunogène: KIF12 antibody was raised using the N terminal of KIF12 corresponding to a region with amino acids SLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIF12 Blocking Peptide, catalog no. 33R-8585, is also available for use as a blocking control in assays to test for specificity of this KIF12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KIF12

Antigène: KIF12 (Kinesin Family Member 12 (KIF12))

Autre désignation: KIF12 (KIF12 Produits)

Synonymes: anticorps DDBDRAFT_0189854, anticorps DDBDRAFT_0201555, anticorps DDB_0189854, anticorps DDB_0201555, anticorps RP11-56P10.3, anticorps kinesin family member 12, anticorps KIF12, anticorps Bm1_06740, anticorps kif12, anticorps Kif12

Sujet: KIF12 is a member of the kinesin superfamily of microtubule-associated molecular motors that play important roles in intracellular transport and cell division.

Poids moléculaire: 56 kDa (MW of target protein)