ORC6 anticorps
-
- Antigène Voir toutes ORC6 Anticorps
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ORC6 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ORC6 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE
- Top Product
- Discover our top product ORC6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ORC6L Blocking Peptide, catalog no. 33R-9488, is also available for use as a blocking control in assays to test for specificity of this ORC6L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ORC6 (Origin Recognition Complex, Subunit 6 (ORC6))
- Autre désignation
- ORC6L (ORC6 Produits)
- Synonymes
- anticorps Orc6l, anticorps CG1584, anticorps DmORC 6, anticorps DmORC6, anticorps Dmel\\CG1584, anticorps ORC, anticorps ORC6, anticorps orc6, anticorps rDmORC, anticorps ORC6L, anticorps ARABIDOPSIS THALIANA ORIGIN RECOGNITION COMPLEX PROTEIN 6, anticorps ATORC6, anticorps ORIGIN RECOGNITION COMPLEX SUBUNIT 6, anticorps T2P11.3, anticorps T2P11_3, anticorps origin recognition complex protein 6, anticorps DDBDRAFT_0186183, anticorps DDBDRAFT_0233113, anticorps DDB_0186183, anticorps DDB_0233113, anticorps LOC100284755, anticorps orc6l, anticorps 6720420I10Rik, anticorps origin recognition complex, subunit 6, anticorps Origin recognition complex subunit 6, anticorps origin recognition complex subunit 6, anticorps origin recognition complex protein 6, anticorps origin recognition complex subunit Orc6, anticorps Orc6, anticorps ORC6, anticorps CpipJ_CPIJ005016, anticorps SJAG_01267, anticorps orcF, anticorps LOC100284755, anticorps orc6
- Sujet
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. gene silencing.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, M Phase, Synthesis of DNA
-