SYCP1 anticorps (N-Term)

N° du produit ABIN634180

Détail du produit anti-SYCP1 anticorps

Antigène: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SYCP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SYCP1 antibody was raised against the N terminal of SYCP1

Purification: Affinity purified

Immunogène: SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SYCP1 Blocking Peptide, catalog no. 33R-6689, is also available for use as a blocking control in assays to test for specificity of this SYCP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SYCP1

Antigène: SYCP1 (Synaptonemal Complex Protein 1 (SYCP1))

Autre désignation: SYCP1 (SYCP1 Produits)

Synonymes: anticorps CT8, anticorps HOM-TES-14, anticorps SCP1, anticorps SYCP1, anticorps T16E15.12, anticorps T16E15_12, anticorps ZYP1, anticorps sycp1, anticorps SCP-1, anticorps syn1, anticorps synaptonemal complex protein 1, anticorps Myosin heavy chain-related protein, anticorps SYCP1, anticorps sycp1, anticorps ZYP1a, anticorps Sycp1

Sujet: SYCP1 is a major component of the transverse filaments of synaptonemal complexes (SCS), which is formed between homologous chromosomes during meiotic prophase.

Poids moléculaire: 107 kDa (MW of target protein)