NUP98 anticorps (N-Term)
-
- Antigène Voir toutes NUP98 Anticorps
- NUP98 (Nucleoporin 98kDa (NUP98))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NUP98 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NUP98 antibody was raised against the N terminal of NUP98
- Purification
- Affinity purified
- Immunogène
- NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
- Top Product
- Discover our top product NUP98 Anticorps primaire
-
anti-Nucleoporin 98kDa (NUP98) (GLFG Motif), (N-Term) antibody
NUP98 Reactivité: Humain, Souris, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Hôte: Souris Monoclonal 21A10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (FGxxN Motif), (N-Term) antibodyNUP98 Reactivité: Humain, Saccharomyces cerevisiae, Schizosaccharomyces pombe, Tetrahymena WB, IF Hôte: Souris Monoclonal 13C2 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-466) antibodyNUP98 Reactivité: Humain, Souris, Rat, Saccharomyces cerevisiae, Schizosaccharomyces pombe WB, ELISA, IF, ICC, DB Hôte: Rat Monoclonal 2H10 unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 965-1110) antibodyNUP98 Reactivité: Humain WB, ELISA, IP, IF Hôte: Lapin Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivité: Humain WB, ELISA, IF, IHC Hôte: Lapin Monoclonal 2H4 unconjugated Recombinant Antibody
anti-Nucleoporin 98kDa (NUP98) (AA 621-920) antibodyNUP98 Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivité: Humain WB, IP Hôte: Souris Monoclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-606) antibodyNUP98 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) antibodyNUP98 Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Nucleoporin 98kDa (NUP98) (AA 1-110) antibodyNUP98 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NUP98 Blocking Peptide, catalog no. 33R-2374, is also available for use as a blocking control in assays to test for specificity of this NUP98 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP98 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NUP98 (Nucleoporin 98kDa (NUP98))
- Autre désignation
- NUP98 (NUP98 Produits)
- Sujet
- The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL).
- Poids moléculaire
- 98 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Protein targeting to Nucleus, SARS-CoV-2 Protein Interactome
-
