RRM2 anticorps (N-Term)

N° du produit ABIN634182

Détail du produit anti-RRM2 anticorps

Antigène: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RRM2 antibody was raised against the N terminal of RRM2

Purification: Affinity purified

Immunogène: RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRM2 Blocking Peptide, catalog no. 33R-6966, is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRM2

Antigène: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Autre désignation: RRM2 (RRM2 Produits)

Synonymes: anticorps R2, anticorps RR2, anticorps RR2M, anticorps AA407299, anticorps rrm2, anticorps rr2m, anticorps cb111, anticorps chunp6884, anticorps r2, anticorps ribonucleotide reductase regulatory subunit M2, anticorps ribonucleotide reductase M2, anticorps ribonucleotide reductase M2, gene 2 L homeolog, anticorps ribonucleotide reductase M2, gene 1, anticorps ribonucleotide reductase M2 polypeptide, anticorps RRM2, anticorps Rrm2, anticorps rrm2.2.L, anticorps rrm2.1, anticorps rrm2

Sujet: RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases