Retinoblastoma Binding Protein 4 anticorps (N-Term)

N° du produit ABIN634184

Détail du produit anti-Retinoblastoma Binding Protein 4 anticorps

Antigène: Retinoblastoma Binding Protein 4 (RBBP4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoblastoma Binding Protein 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBBP4 antibody was raised against the N terminal of RBBP4

Purification: Affinity purified

Immunogène: RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBBP4 Blocking Peptide, catalog no. 33R-3865, is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoblastoma Binding Protein 4

Antigène: Retinoblastoma Binding Protein 4 (RBBP4)

Autre désignation: RBBP4 (RBBP4 Produits)

Synonymes: anticorps NURF55, anticorps RBAP48, anticorps 154659_at, anticorps 55, anticorps CAF-1, anticorps CAF1, anticorps CAF1-55, anticorps CAF1p55, anticorps CG4236, anticorps Caf-1, anticorps Caf1/p55, anticorps Caf1p55, anticorps Dmel\\CG4236, anticorps MSI1/RbAp48/CAC3/LIN-53, anticorps NURF, anticorps NURF-55, anticorps Nurf, anticorps Nurf 55, anticorps Nurf-55, anticorps Nurf55, anticorps P55, anticorps RbAp48, anticorps S(ls)3, anticorps caf-1, anticorps caf1, anticorps caf1 p55, anticorps d-CAF1, anticorps dCAF-1, anticorps dCAF-1 p55, anticorps dNURF, anticorps p55, anticorps p55 CAF1, anticorps p55/NURF-55, anticorps p55CAF1, anticorps nurf55, anticorps rbap48, anticorps xrbbp4, anticorps mRbAp48, anticorps RBBP4, anticorps rbb4-2, anticorps zgc:55349, anticorps zgc:77854, anticorps wu:fb33a09, anticorps wu:fb40e10, anticorps RBBP-4, anticorps rbbp4, anticorps M4E13.110, anticorps M4E13_110, anticorps MULTICOPY SUPPRESSOR OF IRA1 3, anticorps NFC3, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3, anticorps RB binding protein 4, chromatin remodeling factor, anticorps Chromatin assembly factor 1, p55 subunit, anticorps retinoblastoma binding protein 4, anticorps retinoblastoma binding protein 4, chromatin remodeling factor, anticorps retinoblastoma binding protein 4 L homeolog, anticorps Transducin family protein / WD-40 repeat family protein, anticorps retinoblastoma binding protein 4 S homeolog, anticorps RBBP4, anticorps Caf1-55, anticorps rbbp4, anticorps Rbbp4, anticorps rbbp4.L, anticorps MSI3, anticorps rbbp4.S

Sujet: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus