LIG1 anticorps (Middle Region)
-
- Antigène Voir toutes LIG1 Anticorps
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LIG1 antibody was raised against the middle region of LIG1
- Purification
- Affinity purified
- Immunogène
- LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
- Top Product
- Discover our top product LIG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LIG1 Blocking Peptide, catalog no. 33R-7379, is also available for use as a blocking control in assays to test for specificity of this LIG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LIG1 (Ligase I, DNA, ATP-Dependent (LIG1))
- Autre désignation
- LIG1 (LIG1 Produits)
- Synonymes
- anticorps ATLIG1, anticorps DNA ligase 1, anticorps T6D22.23, anticorps ligI, anticorps AL033288, anticorps LigI, anticorps lig1, anticorps wu:fc54a11, anticorps DNA ligase 1, anticorps DNA ligase 1, putative, anticorps ligase I, DNA, ATP-dependent L homeolog, anticorps ligase I, DNA, ATP-dependent, anticorps LIG1, anticorps PB000674.02.0, anticorps PTRG_06243, anticorps PKH_140260, anticorps lig1.L, anticorps Lig1, anticorps lig-1, anticorps lig1
- Sujet
- LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process. Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents.
- Poids moléculaire
- 102 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, Réparation de l'ADN, DNA Replication, Synthesis of DNA
-