MOS anticorps (Middle Region)
-
- Antigène Voir toutes MOS Anticorps
- MOS (Moloney Sarcoma Oncogene (MOS))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MOS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MOS antibody was raised against the middle region of MOS
- Purification
- Affinity purified
- Immunogène
- MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
- Top Product
- Discover our top product MOS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MOS Blocking Peptide, catalog no. 33R-5250, is also available for use as a blocking control in assays to test for specificity of this MOS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MOS (Moloney Sarcoma Oncogene (MOS))
- Autre désignation
- MOS (MOS Produits)
- Synonymes
- anticorps MOS, anticorps c-mos, anticorps msv, anticorps p39, anticorps mosxe, anticorps MSV, anticorps p39-mos, anticorps MOS proto-oncogene, serine/threonine kinase, anticorps v-mos Moloney murine sarcoma viral oncogene homolog, anticorps serine/threonine-protein kinase mos-like, anticorps Moloney sarcoma oncogene, anticorps MOS proto-oncogene, serine/threonine kinase L homeolog, anticorps MOS, anticorps mos, anticorps LOC100229612, anticorps Mos, anticorps mos.L
- Sujet
- MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.
- Poids moléculaire
- 38 kDa (MW of target protein)
-