Septin 2 anticorps (N-Term)

N° du produit ABIN634205

Détail du produit anti-Septin 2 anticorps

Antigène: Septin 2 (SEPT2)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Septin 2 antibody was raised against the N terminal of 40423

Purification: Affinity purified

Immunogène: Septin 2 antibody was raised using the N terminal of 40423 corresponding to a region with amino acids MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Septin 2 Blocking Peptide, catalog no. 33R-6451, is also available for use as a blocking control in assays to test for specificity of this Septin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 37500 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 2

Antigène: Septin 2 (SEPT2)

Autre désignation: Septin 2 (SEPT2 Produits)

Synonymes: anticorps DIFF6, anticorps NEDD5, anticorps Pnutl3, anticorps hNedd5, anticorps AW208991, anticorps Nedd-5, anticorps Nedd5, anticorps mKIAA0158, anticorps Vesp11, anticorps nedd5, anticorps wu:fb52g01, anticorps wu:fb99a01, anticorps Septin-2A, anticorps Septin-A, anticorps diff6, anticorps pnutl3, anticorps sept2, anticorps septa, anticorps xlsepta, anticorps SEPT2, anticorps Sep-02, anticorps Septin-2B, anticorps hnedd5, anticorps sept2-B, anticorps Septin-2, anticorps septin 2, anticorps septin 2 L homeolog, anticorps septin 2-like, anticorps COG1487; VapC; putative nucleic acid-binding protein; contains PIN domain, anticorps septin 2 S homeolog, anticorps SEPT2, anticorps Sept2, anticorps sept2, anticorps sept2.L, anticorps SEPT2L, anticorps sepT2, anticorps sept2.S

Sujet: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

Poids moléculaire: 41 kDa (MW of target protein)