TUBE1 anticorps (Middle Region)

N° du produit ABIN634213

Détail du produit anti-TUBE1 anticorps

Antigène: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Epsilon Tubulin 1 antibody was raised against the middle region of TUBE1

Purification: Affinity purified

Immunogène: Epsilon Tubulin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Epsilon Tubulin 1 Blocking Peptide, catalog no. 33R-3777, is also available for use as a blocking control in assays to test for specificity of this Epsilon Tubulin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBE1

Antigène: TUBE1 (Tubulin, epsilon 1 (TUBE1))

Autre désignation: epsilon Tubulin 1 (TUBE1 Produits)

Synonymes: anticorps zgc:63582, anticorps LOC398412, anticorps TUBE1, anticorps tube, anticorps 2310061K05Rik, anticorps AI551343, anticorps Tube, anticorps TUBE, anticorps dJ142L7.2, anticorps tubulin, epsilon 1, anticorps tubulin epsilon 1 L homeolog, anticorps tubulin epsilon 1, anticorps epsilon tubulin, anticorps putative epsilon tubulin, anticorps Epsilon tubulin, anticorps tubulin epsilon chain, anticorps epsilon-tubulin 1, anticorps tube1, anticorps tube1.L, anticorps TUBE1, anticorps Tc00.1047053509967.160, anticorps Tc00.1047053509695.120, anticorps Tb10.70.6950, anticorps LMJF_21_1010, anticorps GL50803_6336, anticorps TUE, anticorps tubE, anticorps LOC100541905, anticorps Tube1

Sujet: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Dynamique des Microtubules