ANAPC7 anticorps (C-Term)
-
- Antigène Voir toutes ANAPC7 Anticorps
- ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ANAPC7 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- ANAPC7 antibody was raised against the C terminal of ANAPC7
- Purification
- Affinity purified
- Immunogène
- ANAPC7 antibody was raised using the C terminal of ANAPC7 corresponding to a region with amino acids ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS
- Top Product
- Discover our top product ANAPC7 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ANAPC7 Blocking Peptide, catalog no. 33R-1371, is also available for use as a blocking control in assays to test for specificity of this ANAPC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANAPC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ANAPC7 (Anaphase Promoting Complex Subunit 7 (ANAPC7))
- Autre désignation
- ANAPC7 (ANAPC7 Produits)
- Sujet
- The anaphase-promoting complex (APC) consists of at least 8 protein subunits, including APC5, CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).
- Poids moléculaire
- 62 kDa (MW of target protein)
-