PCBP4 anticorps

N° du produit ABIN634227

Détail du produit anti-PCBP4 anticorps

Antigène: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCBP4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGERHV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCBP4 Blocking Peptide, catalog no. 33R-7763, is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCBP4

Antigène: PCBP4 (Poly(rC) Binding Protein 4 (PCBP4))

Autre désignation: PCBP4 (PCBP4 Produits)

Synonymes: anticorps Pcbp4, anticorps zgc:77347, anticorps wu:fc68f03, anticorps PCBP4, anticorps CBP, anticorps LIP4, anticorps MCG10, anticorps 1200003L19Rik, anticorps AlphaCP-4, anticorps poly(rC) binding protein 4, anticorps pcbp4, anticorps PCBP4, anticorps Pcbp4

Sujet: PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.

Poids moléculaire: 47 kDa (MW of target protein)