CDK5RAP1 anticorps (N-Term)

N° du produit ABIN634233

Détail du produit anti-CDK5RAP1 anticorps

Antigène: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDK5RAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDK5 RAP1 antibody was raised against the N terminal of CDK5 AP1

Purification: Affinity purified

Immunogène: CDK5 RAP1 antibody was raised using the N terminal of CDK5 AP1 corresponding to a region with amino acids MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDK5RAP1 Blocking Peptide, catalog no. 33R-6227, is also available for use as a blocking control in assays to test for specificity of this CDK5RAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDK0 AP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDK5RAP1

Antigène: CDK5RAP1 (CDK5 Regulatory Subunit Associated Protein 1 (CDK5RAP1))

Autre désignation: CDK5RAP1 (CDK5RAP1 Produits)

Synonymes: anticorps cdk5rap1, anticorps MGC154823, anticorps C20orf34, anticorps C42, anticorps CGI-05, anticorps HSPC167, anticorps 2310066P17Rik, anticorps CDK5 regulatory subunit associated protein 1, anticorps CDK5 regulatory subunit associated protein 1 L homeolog, anticorps CDK5RAP1, anticorps cdk5rap1, anticorps cdk5rap1.L, anticorps Cdk5rap1

Sujet: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A.

Poids moléculaire: 55 kDa (MW of target protein)