Kallikrein 10 anticorps (N-Term)
-
- Antigène Voir toutes Kallikrein 10 (KLK10) Anticorps
- Kallikrein 10 (KLK10)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Kallikrein 10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLK10 antibody was raised against the N terminal of KLK10
- Purification
- Affinity purified
- Immunogène
- KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
- Top Product
- Discover our top product KLK10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Kallikrein 10 (KLK10)
- Autre désignation
- KLK10 (KLK10 Produits)
- Sujet
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- Système du Complément
-