MAPK13 anticorps (Middle Region)
-
- Antigène Voir toutes MAPK13 Anticorps
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAPK13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAPK13 antibody was raised against the middle region of MAPK13
- Purification
- Affinity purified
- Immunogène
- MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
- Top Product
- Discover our top product MAPK13 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))
- Autre désignation
- MAPK13 (MAPK13 Produits)
- Synonymes
- anticorps F24B9.3, anticorps F24B9_3, anticorps MAPK 13, anticorps MAPK-13, anticorps PRKM13, anticorps SAPK4, anticorps p38delta, anticorps Serk4, anticorps Prkm13, anticorps sapk4, anticorps prkm13, anticorps Protein kinase superfamily protein, anticorps mitogen-activated protein kinase 13, anticorps mitogen activated protein kinase 13, anticorps ATMPK13, anticorps MAPK13, anticorps Mapk13, anticorps mapk13
- Sujet
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins
-