TdT anticorps (Middle Region)
-
- Antigène Voir toutes TdT (DNTT) Anticorps
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TdT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DNTT antibody was raised against the middle region of DNTT
- Purification
- Affinity purified
- Immunogène
- DNTT antibody was raised using the middle region of DNTT corresponding to a region with amino acids LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
- Top Product
- Discover our top product DNTT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNTT Blocking Peptide, catalog no. 33R-5388, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))
- Autre désignation
- DNTT (DNTT Produits)
- Synonymes
- anticorps TdT, anticorps TDT, anticorps BB160593, anticorps Tdt, anticorps dntt-A, anticorps dntt, anticorps DNA nucleotidylexotransferase, anticorps deoxynucleotidyltransferase, terminal, anticorps DNA nucleotidylexotransferase L homeolog, anticorps terminal deoxynucleotidyl transferase, anticorps DNTT, anticorps dntt, anticorps Dntt, anticorps dntt.L, anticorps tdt
- Sujet
- DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor geneegments during the maturation of B- and T-cells.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-