PP5 anticorps (N-Term)
-
- Antigène Voir toutes PP5 (PPP5C) Anticorps
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PP5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PPP5 C antibody was raised against the N terminal of PPP5
- Purification
- Affinity purified
- Immunogène
- PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF
- Top Product
- Discover our top product PPP5C Anticorps primaire
-
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibody
PPP5C Reactivité: Humain WB, IHC, IF, IHC (p), FACS Hôte: Souris Monoclonal 1G2 unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibodyPPP5C Reactivité: Humain, Chien WB, IHC, IF, IHC (p), FACS Hôte: Souris Monoclonal 5G5 unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibodyPPP5C Reactivité: Humain, Rat, Chien, Singe WB, IHC, IHC (p), FACS Hôte: Souris Monoclonal 6C2 unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibodyPPP5C Reactivité: Humain, Rat, Chien, Singe WB, IHC, IHC (p) Hôte: Souris Monoclonal 5A8 unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) (AA 370-488) antibodyPPP5C Reactivité: Humain WB, IHC, IF, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) (AA 1-499) antibodyPPP5C Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibodyPPP5C Reactivité: Humain WB, IF, ICC Hôte: Souris Monoclonal 12F7 unconjugated
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibody (HRP)PPP5C Reactivité: Humain WB, IF, ICC Hôte: Souris Monoclonal 12F7 HRP
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibody (FITC)PPP5C Reactivité: Humain WB, IF, ICC Hôte: Souris Monoclonal 12F7 FITC
anti-Protein Phosphatase 5, Catalytic Subunit (PPP5C) antibody (Alkaline Phosphatase (AP))PPP5C Reactivité: Humain WB, IF, ICC Hôte: Souris Monoclonal 12F7 Alkaline Phosphatase (AP)
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP5C Blocking Peptide, catalog no. 33R-5701, is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))
- Autre désignation
- PPP5C (PPP5C Produits)
- Synonymes
- anticorps PP5, anticorps PPP5, anticorps PPT, anticorps AU020526, anticorps pp5, anticorps MGC89961, anticorps fc83f08, anticorps im:7146608, anticorps wu:fc83f08, anticorps zgc:110801, anticorps PPP5C, anticorps protein phosphatase 5 catalytic subunit, anticorps protein phosphatase 5, catalytic subunit, anticorps protein phosphatase 5, catalytic subunit S homeolog, anticorps serine/threonine-protein phosphatase 5, anticorps PPP5C, anticorps Ppp5c, anticorps ppp5c.S, anticorps ppp5c, anticorps LOC592155, anticorps LOC100513542, anticorps LOC100564151, anticorps LOC100186268, anticorps LOC100208775
- Sujet
- PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
- Poids moléculaire
- 57 kDa (MW of target protein)
-
