RBM14 anticorps (N-Term)

N° du produit ABIN634248

Détail du produit anti-RBM14 anticorps

Antigène: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM14 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBM14 antibody was raised against the N terminal of RBM14

Purification: Affinity purified

Immunogène: RBM14 antibody was raised using the N terminal of RBM14 corresponding to a region with amino acids YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM14 Blocking Peptide, catalog no. 33R-10047, is also available for use as a blocking control in assays to test for specificity of this RBM14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM14

Antigène: RBM14 (RNA Binding Motif Protein 14 (RBM14))

Autre désignation: RBM14 (RBM14 Produits)

Synonymes: anticorps im:7053198, anticorps wu:fc08a04, anticorps zgc:110682, anticorps sip, anticorps coaa, anticorps psp2, anticorps sytip1, anticorps tmem137, anticorps MGC52864, anticorps MGC132117, anticorps MGC75876, anticorps RBM14, anticorps RBM4, anticorps COAA, anticorps PSP2, anticorps SIP, anticorps SYTIP1, anticorps TMEM137, anticorps 1300007E16Rik, anticorps Sytip, anticorps p16, anticorps p16K, anticorps CoAA, anticorps rbm14, anticorps zgc:85696, anticorps RNA binding motif protein 14a, anticorps RNA binding motif protein 14 L homeolog, anticorps RNA binding motif protein 14, anticorps RNA binding motif protein 14b, anticorps rbm14a, anticorps rbm14.L, anticorps rbm14, anticorps RBM14, anticorps Rbm14, anticorps rbm14b

Sujet: RBM14 contains 2 RRM (RNA recognition motif) domains. Isoform 1 may function as a nuclear receptor coactivator, enhancing transcription through other coactivators such as NCOA6 and CITED1. Isoform 2, functions as a transcriptional repressor, modulating transcriptional activities of coactivators including isoform 1, NCOA6 and CITED1.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway