MAPK12 anticorps (N-Term)
-
- Antigène Voir toutes MAPK12 Anticorps
- MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAPK12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAPK12 antibody was raised against the N terminal of MAPK12
- Purification
- Affinity purified
- Immunogène
- MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE
- Top Product
- Discover our top product MAPK12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAPK12 Blocking Peptide, catalog no. 33R-8447, is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAPK12 (Mitogen-Activated Protein Kinase 12 (MAPK12))
- Autre désignation
- MAPK12 (MAPK12 Produits)
- Synonymes
- anticorps ATMPK12, anticorps MAPK12, anticorps T3F17.28, anticorps mitogen-activated protein kinase 12, anticorps MGC160082, anticorps si:dkey-14d8.5, anticorps erk6, anticorps etID309866.18, anticorps mapk12, anticorps sapk3, anticorps wu:fa05c12, anticorps zgc:101695, anticorps ERK3, anticorps ERK6, anticorps P38GAMMA, anticorps PRKM12, anticorps SAPK-3, anticorps SAPK3, anticorps AW123708, anticorps Erk6, anticorps P38gamma, anticorps Prkm12, anticorps Sapk3, anticorps mitogen-activated protein kinase 12, anticorps mitogen-activated protein kinase 12b, anticorps mitogen-activated protein kinase 12a, anticorps MPK12, anticorps MAPK12, anticorps mapk12b, anticorps mapk12a, anticorps Mapk12
- Sujet
- Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation, Hepatitis C, BCR Signaling, S100 Proteins
-