Presenilin 2 anticorps

N° du produit ABIN634258

Détail du produit anti-Presenilin 2 anticorps

Antigène: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Presenilin 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: Presenilin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Presenilin 2 Blocking Peptide, catalog no. 33R-9902, is also available for use as a blocking control in assays to test for specificity of this Presenilin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSEN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Presenilin 2

Antigène: Presenilin 2 (PSEN2) (Presenilin 2 (Alzheimer Disease 4) (PSEN2))

Autre désignation: Presenilin 2 (PSEN2 Produits)

Synonymes: anticorps AD3L, anticorps AD4, anticorps CMD1V, anticorps PS2, anticorps STM2, anticorps ALG-3, anticorps Ad4h, anticorps Alg3, anticorps PS-2, anticorps Psnl2, anticorps pre2, anticorps zf-PS2, anticorps PSNL2, anticorps PSEN2, anticorps ad4, anticorps ps2, anticorps ad3l, anticorps stm2, anticorps Ps2, anticorps presenilin 2, anticorps presenilin 2 S homeolog, anticorps presenilin 2 (Alzheimer disease 4), anticorps trefoil factor 1, anticorps PSEN2, anticorps Psen2, anticorps psen2, anticorps psen2.S, anticorps Tff1

Sujet: Alzheimer's disease (AD) patients with an inherited form of the disease carry mutations in the presenilin proteins (PSEN1 or PSEN2) or the amyloid precursor protein (APP). These disease-linked mutations result in increased production of the longer form of amyloid-beta (main component of amyloid deposits found in AD brains). Presenilins are postulated to regulate APP processing through their effects on gamma-secretase, an enzyme that cleaves APP. Also, it is thought that the presenilins are involved in the cleavage of the Notch receptor such that, they either directly regulate gamma-secretase activity, or themselves act are protease enzymes.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Signalisation Notch, EGFR Signaling Pathway, Neurotrophin Signaling Pathway