LZTS2 anticorps (N-Term)
-
- Antigène Voir toutes LZTS2 Anticorps
- LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LZTS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LZTS2 antibody was raised against the N terminal of LZTS2
- Purification
- Affinity purified
- Immunogène
- LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL
- Top Product
- Discover our top product LZTS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LZTS2 Blocking Peptide, catalog no. 33R-2636, is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))
- Autre désignation
- LZTS2 (LZTS2 Produits)
- Synonymes
- anticorps lapser1, anticorps MGC89253, anticorps si:dkey-250a11.1, anticorps LAPSER1, anticorps BC014695, anticorps mKIAA1813, anticorps Lapser1, anticorps leucine zipper, putative tumor suppressor 2, anticorps leucine zipper tumor suppressor 2, anticorps leucine zipper, putative tumor suppressor 2a, anticorps leucine zipper, putative tumor suppressor 2 S homeolog, anticorps lzts2, anticorps LZTS2, anticorps lzts2a, anticorps Lzts2, anticorps lzts2.S
- Sujet
- LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.
- Poids moléculaire
- 73 kDa (MW of target protein)
-