TGFB3 anticorps (Middle Region)

N° du produit ABIN634272

Détail du produit anti-TGFB3 anticorps

Antigène: TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGFB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TGF beta 3 antibody was raised against the middle region of TGFB3

Purification: Affinity purified

Immunogène: TGF beta 3 antibody was raised using the middle region of TGFB3 corresponding to a region with amino acids DFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGF beta 3 Blocking Peptide, catalog no. 33R-1938, is also available for use as a blocking control in assays to test for specificity of this TGF beta 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGFB3

Antigène: TGFB3 (Transforming Growth Factor, beta 3 (TGFB3))

Autre désignation: TGF beta 3 (TGFB3 Produits)

Synonymes: anticorps TGFB3, anticorps ARVD, anticorps TGF-beta3, anticorps Tgfb-3, anticorps TGF-B3, anticorps TGFbeta3, anticorps wu:fc78g09, anticorps zgc:92058, anticorps transforming growth factor beta 3, anticorps transforming growth factor, beta 3, anticorps TGFB3, anticorps Tgfb3, anticorps tgfb3

Sujet: TGFB3 is involved in embryogenesis and cell differentiation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus