SUN2 anticorps

N° du produit ABIN634274

Détail du produit anti-SUN2 anticorps

Antigène: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUN2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UNC84 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRPDEGWEARDSSPHFQAEQRVMSRVHSLERRLEALAAEFSSNWQKEAM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC84B Blocking Peptide, catalog no. 33R-8772, is also available for use as a blocking control in assays to test for specificity of this UNC84B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUN2

Antigène: SUN2 (Sad1 and UNC84 Domain Containing 2 (SUN2))

Autre désignation: UNC84B (SUN2 Produits)

Synonymes: anticorps UNC84B, anticorps B230369L08Rik, anticorps C030011B15, anticorps Unc84b, anticorps RGD1563141, anticorps Sad1 and UNC84 domain containing 2, anticorps SUN2, anticorps Sun2

Sujet: UNC84B may form a physical interaction between the nuclear envelope and the centrosome.

Poids moléculaire: 80 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2