FICD anticorps (C-Term)

N° du produit ABIN634275

Détail du produit anti-FICD anticorps

Antigène: FICD (FIC Domain Containing (FICD))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FICD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FICD antibody was raised against the C terminal of FICD

Purification: Affinity purified

Immunogène: FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FICD Blocking Peptide, catalog no. 33R-3215, is also available for use as a blocking control in assays to test for specificity of this FICD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FICD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FICD

Antigène: FICD (FIC Domain Containing (FICD))

Autre désignation: FICD (FICD Produits)

Synonymes: anticorps HIP13, anticorps HYPE, anticorps UNQ3041, anticorps D5Ertd40e, anticorps Hype, anticorps FIC domain containing, anticorps FICD, anticorps Ficd

Sujet: FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

Poids moléculaire: 52 kDa (MW of target protein)