RFT1 anticorps
-
- Antigène Voir toutes RFT1 Anticorps
- RFT1 (RFT1 Homolog (RFT1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RFT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RFT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV
- Top Product
- Discover our top product RFT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RFT1 Blocking Peptide, catalog no. 33R-3615, is also available for use as a blocking control in assays to test for specificity of this RFT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RFT1 (RFT1 Homolog (RFT1))
- Autre désignation
- RFT1 (RFT1 Produits)
- Synonymes
- anticorps GB14370, anticorps CDG1N, anticorps D930025H04, anticorps RGD1562654, anticorps protein RFT1 homolog, anticorps RFT1 homolog, anticorps LOC412489, anticorps LOC100453537, anticorps RFT1, anticorps rft1, anticorps LOC100633251, anticorps LOC100651701, anticorps Rft1
- Sujet
- N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of aMan(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.
- Poids moléculaire
- 60 kDa (MW of target protein)
-