DUSP8 anticorps (Middle Region)

N° du produit ABIN634286

Détail du produit anti-DUSP8 anticorps

Antigène: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DUSP8 est non-conjugé

Application: Western Blotting (WB)

Specificité: DUSP8 antibody was raised against the middle region of DUSP8

Purification: Affinity purified

Immunogène: DUSP8 antibody was raised using the middle region of DUSP8 corresponding to a region with amino acids PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUSP8 Blocking Peptide, catalog no. 33R-6973, is also available for use as a blocking control in assays to test for specificity of this DUSP8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DUSP8

Antigène: DUSP8 (Dual Specificity Phosphatase 8 (DUSP8))

Autre désignation: DUSP8 (DUSP8 Produits)

Synonymes: anticorps zgc:77593, anticorps C11orf81, anticorps HB5, anticorps HVH-5, anticorps HVH8, anticorps 5530400B01Rik, anticorps AI593498, anticorps Nttp1, anticorps Hb5, anticorps M3/6, anticorps DUSP8, anticorps dual specificity phosphatase 8, anticorps dual specificity phosphatase 8a, anticorps dual specificity protein phosphatase 8, anticorps DUSP8, anticorps dusp8, anticorps dusp8a, anticorps DSP8, anticorps Dusp8, anticorps LOC615727

Sujet: DUSP8 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli.

Poids moléculaire: 66 kDa (MW of target protein)