ARL5A anticorps (Middle Region)

N° du produit ABIN634288

Détail du produit anti-ARL5A anticorps

Antigène: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL5A est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL5 A antibody was raised against the middle region of ARL5

Purification: Affinity purified

Immunogène: ARL5 A antibody was raised using the middle region of ARL5 corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL5A Blocking Peptide, catalog no. 33R-10153, is also available for use as a blocking control in assays to test for specificity of this ARL5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL5A

Antigène: ARL5A (ADP-Ribosylation Factor-Like 5A (ARL5A))

Autre désignation: ARL5A (ARL5A Produits)

Synonymes: anticorps arl8, anticorps MGC89392, anticorps ARL5A, anticorps arl5a, anticorps zgc:92193, anticorps ARFLP5, anticorps ARL5, anticorps 2410015N24Rik, anticorps 2810410P22Rik, anticorps AA408731, anticorps AW610751, anticorps Arl5, anticorps T25534, anticorps ADP ribosylation factor like GTPase 5B, anticorps ADP ribosylation factor like GTPase 5A, anticorps ADP-ribosylation factor-like 5A, anticorps ADP ribosylation factor like GTPase 5B S homeolog, anticorps ADP-ribosylation factor like GTPase 5A, anticorps ADP-ribosylation factor-like protein 5, anticorps arl5b, anticorps ARL5A, anticorps arl5a, anticorps arl5b.S, anticorps Arl5a, anticorps arl-5

Sujet: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Poids moléculaire: 20 kDa (MW of target protein)