S100A9 anticorps (N-Term)
-
- Antigène Voir toutes S100A9 Anticorps
- S100A9 (S100 Calcium Binding Protein A9 (S100A9))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp S100A9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- S100 A9 antibody was raised against the N terminal of S100 9
- Purification
- Affinity purified
- Immunogène
- S100 A9 antibody was raised using the N terminal of S100 9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLK
- Top Product
- Discover our top product S100A9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
S100A9 Blocking Peptide, catalog no. 33R-6535, is also available for use as a blocking control in assays to test for specificity of this S100A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- S100A9 (S100 Calcium Binding Protein A9 (S100A9))
- Autre désignation
- S100A9 (S100A9 Produits)
- Synonymes
- anticorps 60B8AG, anticorps CAGB, anticorps CFAG, anticorps CGLB, anticorps L1AG, anticorps LIAG, anticorps MAC387, anticorps MIF, anticorps MRP14, anticorps NIF, anticorps P14, anticorps Mrp14, anticorps S100A9, anticorps MRP-14, anticorps p14, anticorps 60B8Ag, anticorps AW546964, anticorps BEE22, anticorps Cagb, anticorps GAGB, anticorps L1Ag, anticorps S100 calcium binding protein A9, anticorps S100 calcium binding protein A9 (calgranulin B), anticorps S100A9, anticorps S100a9
- Sujet
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells.
- Poids moléculaire
- 13 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, S100 Proteins
-