RGS3 anticorps (C-Term)

N° du produit ABIN634296

Détail du produit anti-RGS3 anticorps

Antigène: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS3 antibody was raised against the C terminal of RGS3

Purification: Affinity purified

Immunogène: RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Information d'application

Indications d'application: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS3 Blocking Peptide, catalog no. 33R-4300, is also available for use as a blocking control in assays to test for specificity of this RGS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS3

Antigène: RGS3 (Regulator of G-Protein Signaling 3 (RGS3))

Autre désignation: RGS3 (RGS3 Produits)

Synonymes: anticorps RGS3, anticorps MGC115680, anticorps C2PA, anticorps RGP3, anticorps 4930506N09Rik, anticorps C2PA-RGS3, anticorps C2pa, anticorps PDZ-RGS3, anticorps RGS3S, anticorps SRB-RGS, anticorps regulator of G protein signaling 3, anticorps regulator of G-protein signaling 3 L homeolog, anticorps regulator of G-protein signaling 3, anticorps RGS3, anticorps rgs3.L, anticorps Rgs3

Sujet: RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Poids moléculaire: 101 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling