RanBP3 anticorps (N-Term)
-
- Antigène Voir toutes RanBP3 (RANBP3) Anticorps
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RanBP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RanBP3 antibody was raised against the N terminal of RANBP3
- Purification
- Affinity purified
- Immunogène
- RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
- Top Product
- Discover our top product RANBP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RanBP3 Blocking Peptide, catalog no. 33R-5623, is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
- Autre désignation
- RanBP3 (RANBP3 Produits)
- Synonymes
- anticorps 2610024N24Rik, anticorps AA408221, anticorps ranbp3, anticorps MGC79798, anticorps zgc:63485, anticorps RAN binding protein 3, anticorps RAN binding protein 3 L homeolog, anticorps RAN binding protein 3a, anticorps RANBP3, anticorps Ranbp3, anticorps ranbp3.L, anticorps ranbp3, anticorps ranbp3a
- Sujet
- RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.
- Poids moléculaire
- 62 kDa (MW of target protein)
-